PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00565_0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 459aa    MW: 49670 Da    PI: 5.6626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00565_0070genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.9e-15154195446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT++Ed+ll+++v+++G+  W+++a+++  ++t kqc+ rwq+
    kfl00565_0070 154 WTEDEDKLLYELVARFGTSKWSLVASKFE-NKTNKQCRRRWQT 195
                      *****************************.************7 PP

2Myb_DNA-binding47.34.7e-15203246146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+WT+eEd +l+++++ +G++ W+ Ia+ ++ gRt++  k+r++ 
    kfl00565_0070 203 KGAWTAEEDNQLIEGHAFFGNR-WTDIAKLVP-GRTDNAAKNRYFA 246
                      79********************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-16144196IPR009057Homeodomain-like
PROSITE profilePS5129416.269146197IPR017930Myb domain
SuperFamilySSF466892.64E-27148244IPR009057Homeodomain-like
SMARTSM007176.2E-11150199IPR001005SANT/Myb domain
PfamPF002492.9E-14154195IPR001005SANT/Myb domain
CDDcd001675.08E-13154195No hitNo description
PROSITE profilePS5129420.649198252IPR017930Myb domain
SMARTSM007175.8E-14202250IPR001005SANT/Myb domain
PfamPF002497.4E-14203247IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-17203251IPR009057Homeodomain-like
CDDcd001672.64E-11205248No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MADRWPQQDG RPDLPRTESG SDAGSDTHPK ASDDPIQSPL ASASSGGRAR GLAELPAVRE  60
VLLGTIDRPS PDLQALYQAS GTSVDELLEQ KKAIDCLASA SLINAGVQRQ KKGDSDPGRK  120
RSRSKAEEGH GGQEGGADLN DSGSEKPSKT TTIWTEDEDK LLYELVARFG TSKWSLVASK  180
FENKTNKQCR RRWQTCSNVM GAKGAWTAEE DNQLIEGHAF FGNRWTDIAK LVPGRTDNAA  240
KNRYFALLRK QAASAKAGKP SEEEGGSGLA VLSEDQQVDP RIASAILQAS PGARSELPGQ  300
KRNRPSDDFS AEEVEERVSP RFRGGAAEPS LGRLQGLFFP LEAGLEPGPQ FGQGLNLNLP  360
EARFLQQQKG AQEFRFRRPE GPQPGISFSR PEELPGYFPP REGLRQPHVD AAPLPVIPRP  420
DGAEGGAAGE GGDARQPRQE ASRKESLDLD LNSTPLKWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2615425110107B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.28e-31MYB family protein